PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g104290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 318aa    MW: 36490.5 Da    PI: 5.3185
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g104290.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.6e-1977130457
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     ++++t+eq++ Le  F +++++   ++e++A +lgL+ rqV vWFqNrRa++k+
  Csa11g104290.1  77 KRKLTNEQVNMLEYSFGNEPKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKN 130
                     4589************************************************95 PP

2HD-ZIP_I/II1185.1e-3876167293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +kr+l++eqv++LE sF +e kLe+ rK+++a eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++da++ ++++Le++v +L+e+l+e
  Csa11g104290.1  76 RKRKLTNEQVNMLEYSFGNEPKLESGRKEKIAGELGLDPRQVAVWFQNRRARWKNKKLEEEYAKLKNHHDAVVLSQCQLESQVLKLTEQLSE 167
                     8****************9999*******************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003893.4E-1774135IPR001356Homeobox domain
PROSITE profilePS5007116.19676131IPR001356Homeobox domain
CDDcd000863.17E-1476132No hitNo description
PfamPF000461.3E-1677130IPR001356Homeobox domain
SuperFamilySSF466894.15E-1777139IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-1978138IPR009057Homeodomain-like
PRINTSPR000313.9E-5102111IPR000047Helix-turn-helix motif
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PRINTSPR000313.9E-5111127IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MDHGRLMEED QMVLGSQVYP YTTRTQTSQC IIVNQIDGSS SGGEGSKPVK RRRKRRSKSS  60
SATNEGDVAE IGGMLRKRKL TNEQVNMLEY SFGNEPKLES GRKEKIAGEL GLDPRQVAVW  120
FQNRRARWKN KKLEEEYAKL KNHHDAVVLS QCQLESQVLK LTEQLSEAQN EIRKLSERLE  180
EMPTNSSSSS LSVEANNDAQ FDFELAPETN YNNIPFYMLD NXHLFRHLIL IHHLGKNYSV  240
LKLTEQLSEA QNEIRKLSER LEEMPTNSSS SSLSVEANND AQFDFELAPE TNYNNIPFYM  300
LDNNYLQSME YWDGLYV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14955KRRRKRR
27479LRKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6834770.0AY683477.1 Arabidopsis thaliana homeodomain protein (HB53) mRNA, complete cds.
GenBankBT0248470.0BT024847.1 Arabidopsis thaliana At5g66700 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010444751.11e-136PREDICTED: homeobox-leucine zipper protein ATHB-53-like
SwissprotQ9LVR01e-118ATB53_ARATH; Homeobox-leucine zipper protein ATHB-53
TrEMBLR0GNJ11e-123R0GNJ1_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_80022411e-119(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM126021731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66700.11e-116homeobox 53